PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10011856m
Common NameCICLE_v10011856mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 413aa    MW: 44961.8 Da    PI: 8.3961
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10011856mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.66.8e-26152195144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  Ciclev10011856m 152 DPEPGRCRRTDGKKWRCSRDVVAGHKYCERHMHRGRNRSRKHVE 195
                      79****************************************97 PP

2QLQ54.92.7e-1980116137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      s+F+ aQ+q+L+ Q+l+y+y++a++ vPpeLlq+i+k
  Ciclev10011856m  80 SYFSLAQWQELELQALIYRYMLAGAVVPPELLQPIKK 116
                      79*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.7E-1280116IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.8E-1381114IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.8181116IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.555152196IPR014977WRC domain
PfamPF088791.6E-21153195IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MELHLKQWRD QQHESEQQVS AAKIPKLFLE PHEAQHLHQH QQPMSSGSSA LPLFVPEPTS  60
KVSSLSAFSD STSRFPRMGS YFSLAQWQEL ELQALIYRYM LAGAVVPPEL LQPIKKSLVN  120
SSPYFLHHPL QHYSHFQPAS LQSGYWGRGA MDPEPGRCRR TDGKKWRCSR DVVAGHKYCE  180
RHMHRGRNRS RKHVEIPTPT SSAAAGTTLK TTSSTVNNNN NNNNNNISAA TVAAPSPFAQ  240
MANATTFALS APSPSIDLLQ FNQSSCVSKA AVSKGLFEPQ NEVGNSSDGH ILRPFFDDWP  300
RSFHDHNNCE SNSSRVNSAT CLSISMPGNS SSSDVSLKLS TGNIDEPGSQ GGGREEPQLN  360
WAAGWATHTV ASMGGPLAEA LRSSTSNSNS SPTSVLHQLP RSSASEASYV ST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR6923654e-80FR692365.1 Citrus reshni microsatellite DNA, locus mCrCIR04A02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430277.10.0hypothetical protein CICLE_v10011856mg
SwissprotQ8L8A79e-98GRF4_ARATH; Growth-regulating factor 4
TrEMBLV4SS150.0V4SS15_9R
STRINGVIT_08s0007g03760.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19262667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.13e-74growth-regulating factor 4